PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g12890.1
Common NameLR48_Vigan10g089200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family NF-YB
Protein Properties Length: 91aa    MW: 10211.4 Da    PI: 9.5054
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g12890.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB569.8e-181425697
           NF-YB 56 rekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                    +e+rkt+ngdd++wal++lGf++y+e++  yl+kyr++e+ek
  Vang06g12890.1  1 KENRKTVNGDDICWALSSLGFDNYAEAIARYLHKYRQAEREK 42
                    79*************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471137.18E-13151IPR009072Histone-fold
Gene3DG3DSA:1.10.20.104.5E-17156IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
KENRKTVNGD DICWALSSLG FDNYAEAIAR YLHKYRQAER EKIQNNNKKY EGSATKSLNQ  60
TQLILAPPPP PSLSRVTHDK LQNPPTTDQS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150411e-151AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014511823.11e-56PREDICTED: nuclear transcription factor Y subunit B-4
SwissprotO040275e-21NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLA0A0L9VIY12e-62A0A0L9VIY1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SQC72e-62A0A0S3SQC7_PHAAN; Uncharacterized protein
STRINGGLYMA20G37870.22e-33(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.15e-22nuclear factor Y, subunit B4
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]